PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN25525.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 356aa    MW: 39686.1 Da    PI: 8.5928
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN25525.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.92e-32220275156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+p+LH+rFv+a++qLGG+++AtPk+i+elm+v gLt+++vkSHLQkYRl+
  KHN25525.1 220 KQRRCWSPDLHRRFVDALQQLGGPQVATPKQIRELMQVVGLTNDEVKSHLQKYRLH 275
                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.408217277IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.1E-29218278IPR009057Homeodomain-like
SuperFamilySSF466896.65E-18218278IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-26220275IPR006447Myb domain, plants
PfamPF002491.2E-7222273IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MEVSLDLSLA FVPRRTVCEI LGDIAKSKDG SRRMATIEDL VKRLEDEKKK IEAFKRELPL  60
CMILVNDAIS KLKEEIKGGV RMKDEAVVEE LMKLMKTNSE ANGSLMIVGN ESSDTKNWMN  120
SVQLWNVETK QRNEEGDLFV PSNPIEQKND TNKSVSKTVM KDNKKMSQVP SLGLMSPAVL  180
ELNHRKTESG YGHGSSMIIT SSVEIKGHHQ SQQPQQNPRK QRRCWSPDLH RRFVDALQQL  240
GGPQVATPKQ IRELMQVVGL TNDEVKSHLQ KYRLHFKRPQ GSSIGHANSG LCKMAQDKCG  300
DDKSGSPQGP LFLGGSGKGL SSSGRNSMDT EGDEESDCRN WKGGIHHQLQ PESDVL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0969300.0BT096930.1 Soybean clone JCVI-FLGm-21I16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006601003.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
TrEMBLA0A0B2QVA90.0A0A0B2QVA9_GLYSO; Myb family transcription factor APL
TrEMBLK7MM930.0K7MM93_SOYBN; Uncharacterized protein
STRINGGLYMA17G20520.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-50G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]